PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan015370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family EIL
Protein Properties Length: 596aa    MW: 67506.7 Da    PI: 5.553
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-19392PU_refplantGDBView CDS
gnl|UG|Aan#S55212054PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3509.91.2e-155424161354
                XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
       EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekve 100
                +el++rmw+d+mll+rlk+++k     kea  +++k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipe+gkpv+gasd+LraWWkekv+
  Aan015370  42 DELERRMWRDRMLLRRLKDQNKG----KEA--DNAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPENGKPVSGASDNLRAWWKEKVR 135
                79******************998....454..78899*************************************************************** PP

                XXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG CS
       EIN3 101 fdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphd 200
                fdrngpaai+kyqa++ i+++++++ t + s++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+G+e+ww++lgl+k++gtppykkphd
  Aan015370 136 FDRNGPAAIAKYQADHSIPGKNEDNLT-PVSTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVAPPWWPSGDEEWWSQLGLPKEHGTPPYKKPHD 234
                ********************9888855.************************************************************************ PP

                --HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX....XXXXXXXXXXXXXXXXXXXXXXXXXX.XXXX CS
       EIN3 201 lkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss....slrkqspkvtlsceqkedvegkkeskikhvq 296
                lkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee++ ++++++s        ++s ++ +s+ +++dv+g ++ +i++v+
  Aan015370 235 LKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEAISRKLYPDSCppinGAGTGSGSYLISDTSDYDVDGVEDDQIAEVE 334
                ***************************************************************4434655566*************************** PP

                XXXXXX............................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXXX CS
       EIN3 297 avktta............................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqney 354
                ++k +                             ++++v+krk+++++++    k  ++tc+ +q+r+s+ +l+f+d+ s++++++
  Aan015370 335 ECKPQPvevnniynlgfmgpplaqikgelveipsSESFVQKRKQPSDDQQPP--K--IYTCEYQQCRYSDIRLGFQDRFSRNNHQM 416
                ***9889***************************9********777777765..3..69*************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.0E-13042288No hitNo description
Gene3DG3DSA:1.10.3180.106.3E-75164298IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.48E-61167290IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MGFYGNLDFL SGPNCESERV PEVEQEAAAV EEDYSDEEMD VDELERRMWR DRMLLRRLKD  60
QNKGKEADNA KQRQSQEQAR RKKMSRAQDG ILKYMLKMME VCKAQGFVYG IIPENGKPVS  120
GASDNLRAWW KEKVRFDRNG PAAIAKYQAD HSIPGKNEDN LTPVSTPHTL QELQDTTLGS  180
LLSALMQHCD PPQRRFPLEK GVAPPWWPSG DEEWWSQLGL PKEHGTPPYK KPHDLKKAWK  240
VGVLTAVIKH MSPDIAKIRK LVRQSKCLQD KMTAKESATW LAIINQEEAI SRKLYPDSCP  300
PINGAGTGSG SYLISDTSDY DVDGVEDDQI AEVEECKPQP VEVNNIYNLG FMGPPLAQIK  360
GELVEIPSSE SFVQKRKQPS DDQQPPKIYT CEYQQCRYSD IRLGFQDRFS RNNHQMSCPY  420
RPSPTPNHNP NPPQVNRGGT LNFQMNNLQK EPVFTMPTFA QPKINTGPPV NQLGLPGDGQ  480
RAISDLMSIY ETNHQQHTNR NVTSNLDVIA DHQKQKFPIQ LDDDFFGHAV ESNIPSNQST  540
FMPAGFQFEN KTSYNPAFDA SNNLDFRFVS QSPFNLGGVD FSGESNQTPD MSMWYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A6e-811652981134Protein ETHYLENE INSENSITIVE 3
4zds_B6e-811652981134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002276380.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
RefseqXP_010659025.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLF6HIW50.0F6HIW5_VITVI; Putative uncharacterized protein
STRINGVIT_13s0047g00250.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein